PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_05948
Common NameKK1_006097
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NF-YB
Protein Properties Length: 142aa    MW: 15592.5 Da    PI: 7.1679
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_05948genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB115.62.4e-361623697
          NF-YB 36 qecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                   qecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyv+plkvyl+++re+egek
  C.cajan_05948  1 QECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVDPLKVYLQRFREIEGEK 62
                   8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-31171IPR009072Histone-fold
PfamPF008082.7E-12136IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471133.59E-25190IPR009072Histone-fold
PROSITE patternPS006850319IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.8E-101937No hitNo description
PRINTSPR006151.8E-103856No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
QECVSEFISF ITGEASDKCQ REKRKTINGD DLLWAMTTLG FEDYVDPLKV YLQRFREIEG  60
EKTVAARDKD AASAAATYDY PSPSPSPSPA VMHHHHHHHH HGHGHVYGSP AFHAPVMPMP  120
KPGPLPGPGP GPGPTYPPGR PR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A9e-291573793NF-YB
4awl_B8e-291573894NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A8e-291573894NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880372e-51AB288037.1 Oryza sativa Japonica Group OsHAP3F gene for HAP3 subunit of HAP complex, complete cds.
GenBankAK1116212e-51AK111621.1 Oryza sativa Japonica Group cDNA clone:J013109P12, full insert sequence.
GenBankAK1121182e-51AK112118.1 Oryza sativa Japonica Group cDNA clone:002-139-C11, full insert sequence.
GenBankAP0051932e-51AP005193.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0493C06.
GenBankAP0064582e-51AP006458.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBa0072I06.
GenBankAP0149632e-51AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007142418.14e-59hypothetical protein PHAVU_008G278900g
TrEMBLA0A151U2B11e-101A0A151U2B1_CAJCA; Nuclear transcription factor Y subunit B-3 (Fragment)
STRINGGLYMA18G08620.11e-53(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.15e-41nuclear factor Y, subunit B3